PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_10674_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 337aa    MW: 38700.7 Da    PI: 5.9233
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_10674_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-172471148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          rg W++eEde+l++ ++ +G g+W+++++  g+ R++k+c++rw +yl
  cra_locus_10674_iso_1_len_1008_ver_3 24 RGLWSPEEDEKLIRHITTHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 71
                                          788*******************************************97 PP

2Myb_DNA-binding52.89e-1777120146
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           rg++T++E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w++
  cra_locus_10674_iso_1_len_1008_ver_3  77 RGSFTEQEERTIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 120
                                           89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-271574IPR009057Homeodomain-like
PROSITE profilePS5129418.0191971IPR017930Myb domain
SuperFamilySSF466895.08E-2921118IPR009057Homeodomain-like
SMARTSM007172.6E-132373IPR001005SANT/Myb domain
PfamPF002492.0E-152471IPR001005SANT/Myb domain
CDDcd001675.83E-112771No hitNo description
PROSITE profilePS5129426.22872126IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2575127IPR009057Homeodomain-like
SMARTSM007179.2E-1776124IPR001005SANT/Myb domain
PfamPF002491.9E-1577120IPR001005SANT/Myb domain
CDDcd001673.31E-1179122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
XSGENIKERE IMGHHCCSKQ KVKRGLWSPE EDEKLIRHIT THGHGCWSSV PKLAGLQRCG  60
KSCRLRWINY LRPDLKRGSF TEQEERTIID VHRILGNRWA QIAKHLPGRT DNEVKNFWNS  120
VIKKKLISQG LDPNTHNLLS TQQITKNKNY QKDNNHSSSV FTVDTSPCKE ILPNLSNTFE  180
FQNPNLTQNQ NHLVEFSSCS NSILSSGFGI LNENCMWASN INNVFEQSLM MKSSGAVQED  240
QMQKEEQGVL LEDQQMMKRK LVGEDIINDD QEQLIYRVND DEQLLNNVCD HQSTDINNAM  300
FDDSSNIDFD FMDSALVPPA IYCNMNSIDH IAWDCXX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30241267108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006352616.11e-116PREDICTED: myb-related protein 315-like
TrEMBLA0A068U7D61e-120A0A068U7D6_COFCA; Uncharacterized protein
STRINGSolyc02g082040.2.11e-110(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154